PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun006149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 156aa    MW: 17527.9 Da    PI: 4.3533
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-31512PU_refplantGDBView CDS
gnl|UG|Vun#S45802797PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB76.73.5e-241195387
      NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
               ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ +  
  Vun006149 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCNREEKRTIAPEHVLKALQVLGFGEYIEEVYAAY 95
               6899***************************************************************************986543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-399139IPR009072Histone-fold
SuperFamilySSF471135.8E-3512141IPR009072Histone-fold
PfamPF008088.3E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MEPMDIIGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
VCNREEKRTI APEHVLKALQ VLGFGEYIEE VYAAYEQHKM ETMQDSLKGG KWSNVAEMTE  120
EEALAEQQRM FAEARARMNG GGITSKQPDT DQSLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-361213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509845.11e-112PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_014509844.11e-112PREDICTED: protein Dr1 homolog isoform X1
SwissprotP495921e-92NC2B_ARATH; Protein Dr1 homolog
TrEMBLV7CAL01e-110V7CAL0_PHAVU; Uncharacterized protein
STRINGGLYMA05G07750.11e-106(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.27e-94nuclear factor Y, subunit B13